SCOPe 2.06: Domain d3pnba_: 3pnb A:

Lineage for d3pnba_ (3pnb A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (50 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [226769] (4 PDB entries)

8. Domain d3pnba_: 3pnb A: [214877]
   automated match to d3f3ma_
   complexed with coa

Details for d3pnba_

PDB Entry: 3pnb, 2.11 Å

PDB Description: Phosphopantetheine Adenylyltransferase from Mycobacterium tuberculosis in complex with coenzyme A

PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3pnba_:

Sequence; same for both SEQRES and ATOM records:

>d3pnba_ c.26.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
rysfvssslakevamlggdvsellpepvnrrlrdrln

Timeline for d3pnba_:

• d3pnba_ first appeared in SCOPe 2.03
  
• d3pnba_ appears in SCOPe 2.05
  
• d3pnba_ appears in SCOPe 2.07
  
• d3pnba_ appears in the current release, SCOPe 2.08