Lineage for d3pnba_ (3pnb A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2861021Species Mycobacterium tuberculosis [TaxId:1773] [226769] (5 PDB entries)
  8. 2861026Domain d3pnba_: 3pnb A: [214877]
    automated match to d3f3ma_
    complexed with coa

Details for d3pnba_

PDB Entry: 3pnb (more details), 2.11 Å

PDB Description: Phosphopantetheine Adenylyltransferase from Mycobacterium tuberculosis in complex with coenzyme A
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3pnba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pnba_ c.26.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
rysfvssslakevamlggdvsellpepvnrrlrdrln

SCOPe Domain Coordinates for d3pnba_:

Click to download the PDB-style file with coordinates for d3pnba_.
(The format of our PDB-style files is described here.)

Timeline for d3pnba_: