| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
| Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
| Protein automated matches [190459] (61 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [226769] (5 PDB entries) |
| Domain d3pnba_: 3pnb A: [214877] automated match to d3f3ma_ complexed with coa |
PDB Entry: 3pnb (more details), 2.11 Å
SCOPe Domain Sequences for d3pnba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pnba_ c.26.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
rysfvssslakevamlggdvsellpepvnrrlrdrln
Timeline for d3pnba_: