Lineage for d3pn8a1 (3pn8 A:1-477)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084197Species Streptococcus mutans [TaxId:1309] [195139] (3 PDB entries)
  8. 2084202Domain d3pn8a1: 3pn8 A:1-477 [214875]
    Other proteins in same PDB: d3pn8a2
    automated match to d4f66b_
    complexed with fmt, peg, so4

Details for d3pn8a1

PDB Entry: 3pn8 (more details), 1.69 Å

PDB Description: The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159
PDB Compounds: (A:) Putative phospho-beta-glucosidase

SCOPe Domain Sequences for d3pn8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pn8a1 c.1.8.0 (A:1-477) automated matches {Streptococcus mutans [TaxId: 1309]}
msklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyypnh
eaidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdeclky
giepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfneinnq
anyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcmvam
cpiypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdkkdl
fegtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglryal
nwftdmyhlplfivengfgaidqveadgmvhddyridylgahikemikavdedgvelmgy
tpwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi

SCOPe Domain Coordinates for d3pn8a1:

Click to download the PDB-style file with coordinates for d3pn8a1.
(The format of our PDB-style files is described here.)

Timeline for d3pn8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pn8a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3pn8b_