Lineage for d3pn1a_ (3pn1 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2979301Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 2979381Family d.142.2.0: automated matches [227263] (1 protein)
    not a true family
  6. 2979382Protein automated matches [227054] (5 species)
    not a true protein
  7. 2979385Species Haemophilus influenzae [TaxId:727] [226055] (8 PDB entries)
  8. 2979387Domain d3pn1a_: 3pn1 A: [214874]
    automated match to d3baaa_
    protein/DNA complex; complexed with ivh, iwh

Details for d3pn1a_

PDB Entry: 3pn1 (more details), 2 Å

PDB Description: novel bacterial nad+-dependent dna ligase inhibitors with broad spectrum potency and antibacterial efficacy in vivo
PDB Compounds: (A:) DNA ligase

SCOPe Domain Sequences for d3pn1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pn1a_ d.142.2.0 (A:) automated matches {Haemophilus influenzae [TaxId: 727]}
mtniqtqldnlrktlrqyeyeyhvldnpsvpdseydrlfhqlkalelehpefltsdsptq
rvgakplsgfsqirheipmlsldnafsdaefnafvkriedrlillpkpltfccepkldgl
avsilyvngeltqaatrgdgttgeditanirtirnvplqlltdnpparlevrgevfmpha
gferlnkyalehnektfanprnaaagslrqldpnitskrplvlnaygigiaegvdlptth
yarlqwlksigipvnpeirlcngadevlgfyrdiqnkrsslgydidgtvlkindialqne
lgfiskaprwaiaykfpa

SCOPe Domain Coordinates for d3pn1a_:

Click to download the PDB-style file with coordinates for d3pn1a_.
(The format of our PDB-style files is described here.)

Timeline for d3pn1a_: