SCOPe 2.06: Domain d3pm1b1: 3pm1 B:1-72

Lineage for d3pm1b1 (3pm1 B:1-72)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Multidrug binding protein QacR [68964] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
   Uniprot P23217

8. Domain d3pm1b1: 3pm1 B:1-72 [214870]
   Other proteins in same PDB: d3pm1a2, d3pm1b2
   automated match to d1jt6a1
   complexed with et, so4

Details for d3pm1b1

PDB Entry: 3pm1, 2.8 Å

PDB Description: Structure of QacR E90Q bound to Ethidium

PDB Compounds: (B:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d3pm1b1:

Sequence; same for both SEQRES and ATOM records:

>d3pm1b1 a.4.1.9 (B:1-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
wqeqwkseqika

Timeline for d3pm1b1:

• d3pm1b1 first appeared in SCOPe 2.03
  
• d3pm1b1 appears in SCOPe 2.05
  
• d3pm1b1 appears in SCOPe 2.07
  
• d3pm1b1 appears in the current release, SCOPe 2.08