SCOPe 2.07: Domain d3plia1: 3pli A:1-136

Lineage for d3plia1 (3pli A:1-136)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
   automatically mapped to Pfam PF01014

6. Protein Urate oxidase (uricase) [55634] (3 species)
   duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16

7. Species Aspergillus flavus [TaxId:5059] [55635] (71 PDB entries)

8. Domain d3plia1: 3pli A:1-136 [214862]
   automated match to d1r4ua1
   complexed with aza, n2o, na, xe

Details for d3plia1

PDB Entry: 3pli, 1.68 Å

PDB Description: urate oxidase under 1.8 mpa / 18 bars pressure of equimolar mixture xenon : nitrous oxide

PDB Compounds: (A:) Uricase

SCOPe Domain Sequences for d3plia1:

Sequence; same for both SEQRES and ATOM records:

>d3plia1 d.96.1.4 (A:1-136) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]}
savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
irdseekrnvqvdvve

Timeline for d3plia1:

• d3plia1 first appeared in SCOPe 2.03
  
• d3plia1 appears in SCOPe 2.06
  
• d3plia1 appears in the current release, SCOPe 2.08