Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries) |
Domain d1mcfa2: 1mcf A:112-216 [21486] Other proteins in same PDB: d1mcfa1, d1mcfb1 part of the antibody MCG light chain dimer complexed with ace, bal, dpn, dpr, his |
PDB Entry: 1mcf (more details), 2.7 Å
SCOPe Domain Sequences for d1mcfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mcfa2 b.1.1.2 (A:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
Timeline for d1mcfa2: