Lineage for d3pl6c2 (3pl6 C:114-192)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517688Domain d3pl6c2: 3pl6 C:114-192 [214855]
    Other proteins in same PDB: d3pl6a1, d3pl6a2, d3pl6b1, d3pl6c1
    automated match to d1qrnd2
    complexed with nag

Details for d3pl6c2

PDB Entry: 3pl6 (more details), 2.55 Å

PDB Description: structure of autoimmune tcr hy.1b11 in complex with hla-dq1 and mbp 85-99
PDB Compounds: (C:) T-cell receptor alpha chain

SCOPe Domain Sequences for d3pl6c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pl6c2 b.1.1.2 (C:114-192) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnns

SCOPe Domain Coordinates for d3pl6c2:

Click to download the PDB-style file with coordinates for d3pl6c2.
(The format of our PDB-style files is described here.)

Timeline for d3pl6c2: