Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
Domain d3pl6c2: 3pl6 C:114-192 [214855] Other proteins in same PDB: d3pl6a1, d3pl6a2, d3pl6b1, d3pl6c1 automated match to d1qrnd2 complexed with nag |
PDB Entry: 3pl6 (more details), 2.55 Å
SCOPe Domain Sequences for d3pl6c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pl6c2 b.1.1.2 (C:114-192) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnns
Timeline for d3pl6c2:
View in 3D Domains from other chains: (mouse over for more information) d3pl6a1, d3pl6a2, d3pl6b1, d3pl6b2 |