SCOPe 2.08: Domain d3pl6c2: 3pl6 C:114-192

Lineage for d3pl6c2 (3pl6 C:114-192)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3pl6c2: 3pl6 C:114-192 [214855]
   Other proteins in same PDB: d3pl6a1, d3pl6a2, d3pl6b1, d3pl6c1
   automated match to d1qrnd2
   complexed with nag

Details for d3pl6c2

PDB Entry: 3pl6, 2.55 Å

PDB Description: structure of autoimmune tcr hy.1b11 in complex with hla-dq1 and mbp 85-99

PDB Compounds: (C:) T-cell receptor alpha chain

SCOPe Domain Sequences for d3pl6c2:

Sequence; same for both SEQRES and ATOM records:

>d3pl6c2 b.1.1.2 (C:114-192) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnns

Timeline for d3pl6c2:

• d3pl6c2 first appeared in SCOPe 2.03
  
• d3pl6c2 appears in SCOPe 2.07