SCOPe 2.05: Domain d3pl6b2: 3pl6 B:95-191

Lineage for d3pl6b2 (3pl6 B:95-191)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d3pl6b2: 3pl6 B:95-191 [214853]
   Other proteins in same PDB: d3pl6a1, d3pl6a2, d3pl6b1, d3pl6c1
   automated match to d1uvqb1
   complexed with nag

Details for d3pl6b2

PDB Entry: 3pl6, 2.55 Å

PDB Description: structure of autoimmune tcr hy.1b11 in complex with hla-dq1 and mbp 85-99

PDB Compounds: (B:) MHC class II HLA-DQ-beta chain

SCOPe Domain Sequences for d3pl6b2:

Sequence, based on SEQRES records:

>d3pl6b2 b.1.1.2 (B:95-191) automated matches {Human (Homo sapiens) [TaxId: 9606]}
veptvtispsrtealnhhnllicsvtdfypsqikvrwfrndqeetagvvstplirngdwt
fqilvmlemtpqrgdvytchvehpslqspitvewraq

Sequence, based on observed residues (ATOM records):

>d3pl6b2 b.1.1.2 (B:95-191) automated matches {Human (Homo sapiens) [TaxId: 9606]}
veptvtispsnllicsvtdfypsqikvrwfrndqeetagvvstplirngdwtfqilvmle
mtpqrgdvytchvehpslqspitvewraq

Timeline for d3pl6b2:

• d3pl6b2 first appeared in SCOPe 2.03
  
• d3pl6b2 appears in SCOPe 2.04
  
• d3pl6b2 appears in SCOPe 2.06
  
• d3pl6b2 appears in the current release, SCOPe 2.08