Lineage for d3pl6b1 (3pl6 B:3-94)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1642652Protein automated matches [191280] (3 species)
    not a true protein
  7. 1642659Species Human (Homo sapiens) [TaxId:9606] [189896] (24 PDB entries)
  8. 1642685Domain d3pl6b1: 3pl6 B:3-94 [214852]
    Other proteins in same PDB: d3pl6a1, d3pl6a2, d3pl6b2, d3pl6c1, d3pl6c2
    automated match to d1uvqb2
    complexed with nag

Details for d3pl6b1

PDB Entry: 3pl6 (more details), 2.55 Å

PDB Description: structure of autoimmune tcr hy.1b11 in complex with hla-dq1 and mbp 85-99
PDB Compounds: (B:) MHC class II HLA-DQ-beta chain

SCOPe Domain Sequences for d3pl6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pl6b1 d.19.1.1 (B:3-94) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkglcyftngtervrgvtrhiynreeyvrfdsdvgvyravtpqgrpvaeywn
sqkevlegarasvdrvcrhnyevayrgilqrr

SCOPe Domain Coordinates for d3pl6b1:

Click to download the PDB-style file with coordinates for d3pl6b1.
(The format of our PDB-style files is described here.)

Timeline for d3pl6b1: