Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (42 PDB entries) |
Domain d3pl6a1: 3pl6 A:-1-81 [214850] Other proteins in same PDB: d3pl6a2, d3pl6b1, d3pl6b2, d3pl6c1, d3pl6c2 automated match to d1iaka2 complexed with nag |
PDB Entry: 3pl6 (more details), 2.55 Å
SCOPe Domain Sequences for d3pl6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pl6a1 d.19.1.0 (A:-1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]} divadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpqg alrnmavakhnlnimikrynsta
Timeline for d3pl6a1:
View in 3D Domains from other chains: (mouse over for more information) d3pl6b1, d3pl6b2, d3pl6c1, d3pl6c2 |