Lineage for d3pkzb_ (3pkz B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136876Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2136877Superfamily c.53.1: Resolvase-like [53041] (2 families) (S)
    automatically mapped to Pfam PF00239
  5. 2136901Family c.53.1.0: automated matches [227230] (1 protein)
    not a true family
  6. 2136902Protein automated matches [226976] (3 species)
    not a true protein
  7. 2136906Species Staphylococcus aureus [TaxId:1280] [226158] (5 PDB entries)
  8. 2136908Domain d3pkzb_: 3pkz B: [214839]
    automated match to d2rslc_
    complexed with edo, gol, so4

Details for d3pkzb_

PDB Entry: 3pkz (more details), 1.8 Å

PDB Description: Structural basis for catalytic activation of a serine recombinase
PDB Compounds: (B:) Recombinase Sin

SCOPe Domain Sequences for d3pkzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pkzb_ c.53.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdliirilamv
seqe

SCOPe Domain Coordinates for d3pkzb_:

Click to download the PDB-style file with coordinates for d3pkzb_.
(The format of our PDB-style files is described here.)

Timeline for d3pkzb_: