| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Trypanosoma cruzi [TaxId:5693] [226152] (1 PDB entry) |
| Domain d3pjqa2: 3pjq A:409-633 [214811] Other proteins in same PDB: d3pjqa1, d3pjqa3 automated match to d1n1ta1 mutant |
PDB Entry: 3pjq (more details), 2.1 Å
SCOPe Domain Sequences for d3pjqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pjqa2 b.29.1.0 (A:409-633) automated matches {Trypanosoma cruzi [TaxId: 5693]}
gcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpvsq
qgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqpiy
gstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyvgg
ykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteahm
Timeline for d3pjqa2: