Lineage for d3pjqa2 (3pjq A:409-633)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781411Species Trypanosoma cruzi [TaxId:5693] [226152] (1 PDB entry)
  8. 2781412Domain d3pjqa2: 3pjq A:409-633 [214811]
    Other proteins in same PDB: d3pjqa1, d3pjqa3
    automated match to d1n1ta1
    mutant

Details for d3pjqa2

PDB Entry: 3pjq (more details), 2.1 Å

PDB Description: trypanosoma cruzi trans-sialidase-like inactive isoform (including the natural mutation tyr342his) in complex with lactose
PDB Compounds: (A:) Trans-sialidase

SCOPe Domain Sequences for d3pjqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pjqa2 b.29.1.0 (A:409-633) automated matches {Trypanosoma cruzi [TaxId: 5693]}
gcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpvsq
qgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqpiy
gstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyvgg
ykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteahm

SCOPe Domain Coordinates for d3pjqa2:

Click to download the PDB-style file with coordinates for d3pjqa2.
(The format of our PDB-style files is described here.)

Timeline for d3pjqa2: