Lineage for d3pjqa1 (3pjq A:1-399)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065266Protein automated matches [193245] (14 species)
    not a true protein
  7. 2065362Species Trypanosoma cruzi [TaxId:5693] [226151] (1 PDB entry)
  8. 2065363Domain d3pjqa1: 3pjq A:1-399 [214810]
    Other proteins in same PDB: d3pjqa2, d3pjqa3
    automated match to d1n1ta2
    complexed with lbt; mutant

Details for d3pjqa1

PDB Entry: 3pjq (more details), 2.1 Å

PDB Description: trypanosoma cruzi trans-sialidase-like inactive isoform (including the natural mutation tyr342his) in complex with lactose
PDB Compounds: (A:) Trans-sialidase

SCOPe Domain Sequences for d3pjqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pjqa1 b.68.1.1 (A:1-399) automated matches {Trypanosoma cruzi [TaxId: 5693]}
lapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfdn
slidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrsyw
tshgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggag
vaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkl
iintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmrvm
lfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensahssvlykddklyclheins
nevyslvfarlvgelriiksvlqswknwdshlssictpa

SCOPe Domain Coordinates for d3pjqa1:

Click to download the PDB-style file with coordinates for d3pjqa1.
(The format of our PDB-style files is described here.)

Timeline for d3pjqa1: