SCOP 1.63: Domain d1mckb2: 1mck B:112-216

Lineage for d1mckb2 (1mck B:112-216)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Lambda L chain dimer MCG (human) [49117] (18 PDB entries)

8. Domain d1mckb2: 1mck B:112-216 [21481]
   Other proteins in same PDB: d1mcka1, d1mckb1
   complexed with nh2

Details for d1mckb2

PDB Entry: 1mck, 2.7 Å

PDB Description: principles and pitfalls in designing site directed peptide ligands

SCOP Domain Sequences for d1mckb2:

Sequence; same for both SEQRES and ATOM records:

>d1mckb2 b.1.1.2 (B:112-216) Immunoglobulin (constant domains of L and H chains) {Lambda L chain dimer MCG (human)}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

Timeline for d1mckb2:

• d1mckb2 first appeared (with stable ids) in SCOP 1.55
  
• d1mckb2 appears in SCOP 1.61
  
• d1mckb2 appears in SCOP 1.65
  
• d1mckb2 appears in the current release, SCOPe 2.08