Lineage for d3phjb1 (3phj B:1-104)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143051Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2143052Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2143365Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2143366Protein automated matches [226864] (29 species)
    not a true protein
  7. 2143449Species Helicobacter pylori [TaxId:85962] [226243] (10 PDB entries)
  8. 2143461Domain d3phjb1: 3phj B:1-104 [214798]
    Other proteins in same PDB: d3phja2, d3phjb2
    automated match to d1p77a2
    complexed with dhk

Details for d3phjb1

PDB Entry: 3phj (more details), 2.3 Å

PDB Description: Shikimate 5-Dehydrogenase (aroE) from Helicobacter pylori in complex with 3-Dehydroshikimate
PDB Compounds: (B:) Shikimate dehydrogenase

SCOPe Domain Sequences for d3phjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3phjb1 c.58.1.0 (B:1-104) automated matches {Helicobacter pylori [TaxId: 85962]}
mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls
ganvtlpfkerafqvcdkikgialecgavntlvlendelvgynt

SCOPe Domain Coordinates for d3phjb1:

Click to download the PDB-style file with coordinates for d3phjb1.
(The format of our PDB-style files is described here.)

Timeline for d3phjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3phjb2