![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
![]() | Protein automated matches [226864] (40 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:85962] [226243] (10 PDB entries) |
![]() | Domain d3phja1: 3phj A:1-104 [214796] Other proteins in same PDB: d3phja2, d3phjb2 automated match to d1p77a2 complexed with dhk |
PDB Entry: 3phj (more details), 2.3 Å
SCOPe Domain Sequences for d3phja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3phja1 c.58.1.0 (A:1-104) automated matches {Helicobacter pylori [TaxId: 85962]} mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls ganvtlpfkerafqvcdkikgialecgavntlvlendelvgynt
Timeline for d3phja1: