SCOPe 2.05: Domain d3phib2: 3phi B:105-262

Lineage for d3phib2 (3phi B:105-262)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [226244] (12 PDB entries)

8. Domain d3phib2: 3phi B:105-262 [214795]
   Other proteins in same PDB: d3phia1, d3phib1
   automated match to d1p77a1
   complexed with ndp, skm

Details for d3phib2

PDB Entry: 3phi, 2.04 Å

PDB Description: Shikimate 5-Dehydrogenase (aroE) from Helicobacter pylori in complex with Shikimate and NADPH

PDB Compounds: (B:) Shikimate dehydrogenase

SCOPe Domain Sequences for d3phib2:

Sequence, based on SEQRES records:

>d3phib2 c.2.1.0 (B:105-262) automated matches {Helicobacter pylori [TaxId: 85962]}
dalgfylslkqknyqnalilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdc
fmeppksafdliinatsaslhnelplnkevlkgyfkegklaydlaygfltpflslakelk
tpfqdgkdmliyqaalsfekfsasqipyskafevmrsv

Sequence, based on observed residues (ATOM records):

>d3phib2 c.2.1.0 (B:105-262) automated matches {Helicobacter pylori [TaxId: 85962]}
dalgfylslkyqnalilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdcfme
ppksafdliinatsaslhnelplnkevlkgyfkegklaydlaygfltpflslakelktpf
qdgkdmliyqaalsfekfsasqipyskafevmrsv

Timeline for d3phib2:

• d3phib2 first appeared in SCOPe 2.03
  
• d3phib2 appears in SCOPe 2.04
  
• d3phib2 appears in SCOPe 2.06
  
• d3phib2 appears in the current release, SCOPe 2.08