SCOPe 2.06: Domain d3phha2: 3phh A:105-263

Lineage for d3phha2 (3phh A:105-263)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [226244] (12 PDB entries)

8. Domain d3phha2: 3phh A:105-263 [214791]
   Other proteins in same PDB: d3phha1
   automated match to d1p77a1
   complexed with skm

Details for d3phha2

PDB Entry: 3phh, 1.42 Å

PDB Description: Shikimate 5-Dehydrogenase (aroE) from Helicobacter pylori in complex with Shikimate

PDB Compounds: (A:) Shikimate dehydrogenase

SCOPe Domain Sequences for d3phha2:

Sequence, based on SEQRES records:

>d3phha2 c.2.1.0 (A:105-263) automated matches {Helicobacter pylori [TaxId: 85962]}
dalgfylslkqknyqnalilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdc
fmeppksafdliinatsaslhnelplnkevlkgyfkegklaydlaygfltpflslakelk
tpfqdgkdmliyqaalsfekfsasqipyskafevmrsvf

Sequence, based on observed residues (ATOM records):

>d3phha2 c.2.1.0 (A:105-263) automated matches {Helicobacter pylori [TaxId: 85962]}
dalgfylslkyqnalilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdcfme
ppksafdliinatsaslhnelplnkevlkgyfkegklaydlaygfltpflslakelktpf
qdgkdmliyqaalsfekfsasqipyskafevmrsvf

Timeline for d3phha2:

• d3phha2 first appeared in SCOPe 2.03
  
• d3phha2 appears in SCOPe 2.05
  
• d3phha2 appears in SCOPe 2.07
  
• d3phha2 appears in the current release, SCOPe 2.08