Lineage for d3phha2 (3phh A:105-263)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847029Species Helicobacter pylori [TaxId:85962] [226244] (12 PDB entries)
  8. 2847030Domain d3phha2: 3phh A:105-263 [214791]
    Other proteins in same PDB: d3phha1
    automated match to d1p77a1
    complexed with skm

Details for d3phha2

PDB Entry: 3phh (more details), 1.42 Å

PDB Description: Shikimate 5-Dehydrogenase (aroE) from Helicobacter pylori in complex with Shikimate
PDB Compounds: (A:) Shikimate dehydrogenase

SCOPe Domain Sequences for d3phha2:

Sequence, based on SEQRES records: (download)

>d3phha2 c.2.1.0 (A:105-263) automated matches {Helicobacter pylori [TaxId: 85962]}
dalgfylslkqknyqnalilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdc
fmeppksafdliinatsaslhnelplnkevlkgyfkegklaydlaygfltpflslakelk
tpfqdgkdmliyqaalsfekfsasqipyskafevmrsvf

Sequence, based on observed residues (ATOM records): (download)

>d3phha2 c.2.1.0 (A:105-263) automated matches {Helicobacter pylori [TaxId: 85962]}
dalgfylslkyqnalilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdcfme
ppksafdliinatsaslhnelplnkevlkgyfkegklaydlaygfltpflslakelktpf
qdgkdmliyqaalsfekfsasqipyskafevmrsvf

SCOPe Domain Coordinates for d3phha2:

Click to download the PDB-style file with coordinates for d3phha2.
(The format of our PDB-style files is described here.)

Timeline for d3phha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3phha1