SCOPe 2.06: Domain d3phca_: 3phc A:

Lineage for d3phca_ (3phc A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (13 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [226822] (1 PDB entry)

8. Domain d3phca_: 3phc A: [214780]
   automated match to d2bsxa_
   complexed with im5, k, po4

Details for d3phca_

PDB Entry: 3phc, 2 Å

PDB Description: crystal structure of plasmodium falciparum purine nucleoside phosphorylase in complex with dadme-immg

PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d3phca_:

Sequence; same for both SEQRES and ATOM records:

>d3phca_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
nllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcv
shgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshlli
hgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavve
melatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgacaklat
kya

Timeline for d3phca_:

• d3phca_ first appeared in SCOPe 2.03
  
• d3phca_ appears in SCOPe 2.05
  
• d3phca_ appears in SCOPe 2.07
  
• d3phca_ appears in the current release, SCOPe 2.08