Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (55 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:272620] [226041] (1 PDB entry) |
Domain d3pgvc_: 3pgv C: [214778] automated match to d1nf2a_ complexed with ca, edo, epe, gol |
PDB Entry: 3pgv (more details), 2.39 Å
SCOPe Domain Sequences for d3pgvc_:
Sequence, based on SEQRES records: (download)
>d3pgvc_ c.108.1.0 (C:) automated matches {Klebsiella pneumoniae [TaxId: 272620]} myqvvasdldgtllspdhfltpyaketlklltarginfvfatgrhyidvgqirdnlgirs ymitsngarvhdsdgqqifahnldrdiaadlfeivrndpkivtnvyredewymnrhrpee mrffkeavfnyklyepgeldpqgiskvfftcedhehllpleqamnarwgdrvnvsfstlt clevmaggvskghaleavakmlgytlsdciafgdgmndaemlsmagkgcimanahqrlkd lhpelevigsnaddavprylrklyld
>d3pgvc_ c.108.1.0 (C:) automated matches {Klebsiella pneumoniae [TaxId: 272620]} myqvvasdldgtllspdhfltpyaketlklltarginfvfatgrhyidvgqirdnlgirs ymitsngarvhdsdgqqifahnldrdiaadlfeivrndpkivtnvyredewymnrhrpav fnyklyepgeldpqgiskvfftcedhehllpleqamnarwgdrvnvsfstltclevmagg vskghaleavakmlgytlsdciafgdgmndaemlsmagkgcimanahqrlkdlhpelevi gsnaddavprylrklyld
Timeline for d3pgvc_: