SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3pgvb_ (3pgv B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2149297Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2149298Protein automated matches [190447] (51 species)
    not a true protein
  7. 2149537Species Klebsiella pneumoniae [TaxId:272620] [226041] (1 PDB entry)
  8. 2149539Domain d3pgvb_: 3pgv B: [214777]
    automated match to d1nf2a_
    complexed with ca, edo, epe, gol

Details for d3pgvb_

PDB Entry: 3pgv (more details), 2.39 Å

PDB Description: Crystal structure of a haloacid dehalogenase-like hydrolase (KPN_04322) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 2.39 A resolution
PDB Compounds: (B:) Haloacid dehalogenase-like hydrolase

SCOPe Domain Sequences for d3pgvb_:

Sequence, based on SEQRES records: (download)

>d3pgvb_ c.108.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
myqvvasdldgtllspdhfltpyaketlklltarginfvfatgrhyidvgqirdnlgirs
ymitsngarvhdsdgqqifahnldrdiaadlfeivrndpkivtnvyredewymnrhrpee
mrffkeavfnyklyepgeldpqgiskvfftcedhehllpleqamnarwgdrvnvsfstlt
clevmaggvskghaleavakmlgytlsdciafgdgmndaemlsmagkgcimanahqrlkd
lhpelevigsnaddavprylrklyld

Sequence, based on observed residues (ATOM records): (download)

>d3pgvb_ c.108.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
myqvvasdldgtllspdhfltpyaketlklltarginfvfatgrhyidvgqirdnlgirs
ymitsngarvhdsdgqqifahnldrdiaadlfeivrndpkivtnvyredewymnrhrpvf
nyklyepgeldpqgiskvfftcedhehllpleqamnarwgdrvnvsfstltclevmaggv
skghaleavakmlgytlsdciafgdgmndaemlsmagkgcimanahqrlkdlhpelevig
snaddavprylrklyld

SCOPe Domain Coordinates for d3pgvb_:

Click to download the PDB-style file with coordinates for d3pgvb_.
(The format of our PDB-style files is described here.)

Timeline for d3pgvb_: