Lineage for d3pgvb_ (3pgv B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2149297Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2149298Protein automated matches [190447] (50 species)
    not a true protein
  7. 2149537Species Klebsiella pneumoniae [TaxId:272620] [226041] (1 PDB entry)
  8. 2149539Domain d3pgvb_: 3pgv B: [214777]
    automated match to d1nf2a_
    complexed with ca, edo, epe, gol

Details for d3pgvb_

PDB Entry: 3pgv (more details), 2.39 Å

PDB Description: Crystal structure of a haloacid dehalogenase-like hydrolase (KPN_04322) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 2.39 A resolution
PDB Compounds: (B:) Haloacid dehalogenase-like hydrolase

SCOPe Domain Sequences for d3pgvb_:

Sequence, based on SEQRES records: (download)

>d3pgvb_ c.108.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
myqvvasdldgtllspdhfltpyaketlklltarginfvfatgrhyidvgqirdnlgirs
ymitsngarvhdsdgqqifahnldrdiaadlfeivrndpkivtnvyredewymnrhrpee
mrffkeavfnyklyepgeldpqgiskvfftcedhehllpleqamnarwgdrvnvsfstlt
clevmaggvskghaleavakmlgytlsdciafgdgmndaemlsmagkgcimanahqrlkd
lhpelevigsnaddavprylrklyld

Sequence, based on observed residues (ATOM records): (download)

>d3pgvb_ c.108.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
myqvvasdldgtllspdhfltpyaketlklltarginfvfatgrhyidvgqirdnlgirs
ymitsngarvhdsdgqqifahnldrdiaadlfeivrndpkivtnvyredewymnrhrpvf
nyklyepgeldpqgiskvfftcedhehllpleqamnarwgdrvnvsfstltclevmaggv
skghaleavakmlgytlsdciafgdgmndaemlsmagkgcimanahqrlkdlhpelevig
snaddavprylrklyld

SCOPe Domain Coordinates for d3pgvb_:

Click to download the PDB-style file with coordinates for d3pgvb_.
(The format of our PDB-style files is described here.)

Timeline for d3pgvb_: