SCOPe 2.06: Domain d3pgqc1: 3pgq C:1491-1814

Lineage for d3pgqc1 (3pgq C:1491-1814)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins)
   Pfam PF01039
   the active site is formed by two different homologous subunits or domains of this fold

6. Protein automated matches [226926] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225864] (7 PDB entries)

8. Domain d3pgqc1: 3pgq C:1491-1814 [214774]
   automated match to d1uyrb1
   complexed with gy3

Details for d3pgqc1

PDB Entry: 3pgq, 2.8 Å

PDB Description: crystal structure of the carboxyltransferase domain of s. cerevisiae acetyl coa carboxylase in complex with pinoxaden

PDB Compounds: (C:) acetyl-coa carboxylase

SCOPe Domain Sequences for d3pgqc1:

Sequence; same for both SEQRES and ATOM records:

>d3pgqc1 c.14.1.4 (C:1491-1814) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedengel
teverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvtey
arkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkkfd
kensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlvtc
rsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngvsh
ltavddlagvekivewmsyvpakr

Timeline for d3pgqc1:

• d3pgqc1 first appeared in SCOPe 2.03
  
• d3pgqc1 appears in SCOPe 2.05
  
• d3pgqc1 appears in SCOPe 2.07
  
• d3pgqc1 appears in the current release, SCOPe 2.08