Lineage for d3mcg22 (3mcg 2:112-216)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 protein domains)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9225Species Lambda L chain dimer MCG (human) [49117] (18 PDB entries)
  8. 9231Domain d3mcg22: 3mcg 2:112-216 [21477]
    Other proteins in same PDB: d3mcg11, d3mcg21

Details for d3mcg22

PDB Entry: 3mcg (more details), 2 Å

PDB Description: three-dimensional structure of a light chain dimer crystallized in water. conformational flexibility of a molecule in two crystal forms

SCOP Domain Sequences for d3mcg22:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mcg22 b.1.1.2 (2:112-216) Immunoglobulin (constant domains of L and H chains) {Lambda L chain dimer MCG (human)}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOP Domain Coordinates for d3mcg22:

Click to download the PDB-style file with coordinates for d3mcg22.
(The format of our PDB-style files is described here.)

Timeline for d3mcg22:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mcg21