Lineage for d3pgfa_ (3pgf A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2144348Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 2144366Species Escherichia coli [TaxId:562] [53863] (65 PDB entries)
    Uniprot P02928
  8. 2144399Domain d3pgfa_: 3pgf A: [214767]
    Other proteins in same PDB: d3pgfl1, d3pgfl2
    automated match to d1iuda_
    complexed with gol, imd

Details for d3pgfa_

PDB Entry: 3pgf (more details), 2.1 Å

PDB Description: crystal structure of maltose bound mbp with a conformationally specific synthetic antigen binder (sab)
PDB Compounds: (A:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d3pgfa_:

Sequence, based on SEQRES records: (download)

>d3pgfa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtn

Sequence, based on observed residues (ATOM records): (download)

>d3pgfa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadgkydikdvgvdnagak
agltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygvtvlpt
fkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgavalksyee
elakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkdaqtn

SCOPe Domain Coordinates for d3pgfa_:

Click to download the PDB-style file with coordinates for d3pgfa_.
(The format of our PDB-style files is described here.)

Timeline for d3pgfa_: