Lineage for d3pg8b1 (3pg8 B:71-338)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086072Family c.1.10.4: Class I DAHP synthetase [51599] (3 protein domains)
  6. 2086269Protein automated matches [190083] (8 species)
    not a true protein
  7. 2086365Species Thermotoga maritima [TaxId:2336] [186804] (3 PDB entries)
  8. 2086371Domain d3pg8b1: 3pg8 B:71-338 [214766]
    Other proteins in same PDB: d3pg8a2, d3pg8b2
    automated match to d1o60a_
    complexed with azi, gol

Details for d3pg8b1

PDB Entry: 3pg8 (more details), 2 Å

PDB Description: Truncated form of 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase from Thermotoga maritima
PDB Compounds: (B:) phospho-2-dehydro-3-deoxyheptonate aldolase

SCOPe Domain Sequences for d3pg8b1:

Sequence, based on SEQRES records: (download)

>d3pg8b1 c.1.10.4 (B:71-338) automated matches {Thermotoga maritima [TaxId: 2336]}
lvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflselgvkvlrggay
kprtspysfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadiiqigarnaqn
frllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergirtfekatrntl
disavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevhpepekalsdg
kqsldfelfkelvqemkkladalgvkvn

Sequence, based on observed residues (ATOM records): (download)

>d3pg8b1 c.1.10.4 (B:71-338) automated matches {Thermotoga maritima [TaxId: 2336]}
lvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflselgvkvlrggay
klgekgleylreaadkygmyvvtealgeddlpkvaeyadiiqigarnaqnfrllskagsy
nkpvllkrgfmntieefllsaeyiansgntkiilcergirtfekatrntldisavpiirk
eshlpilvdpshsggrrdlviplsraaiavgahgiivevhpepekalsdgkqsldfelfk
elvqemkkladalgvkvn

SCOPe Domain Coordinates for d3pg8b1:

Click to download the PDB-style file with coordinates for d3pg8b1.
(The format of our PDB-style files is described here.)

Timeline for d3pg8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pg8b2