Class a: All alpha proteins [46456] (285 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (18 species) not a true protein |
Species Mycobacterium thermoresistibile [TaxId:1797] [225913] (2 PDB entries) |
Domain d3pfdd2: 3pfd D:239-389 [214763] Other proteins in same PDB: d3pfda1, d3pfdb1, d3pfdc1, d3pfdd1 automated match to d1jqia1 complexed with fda, iod |
PDB Entry: 3pfd (more details), 2.1 Å
SCOPe Domain Sequences for d3pfdd2:
Sequence, based on SEQRES records: (download)
>d3pfdd2 a.29.3.0 (D:239-389) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]} tgfktalatldhtrptigaqavgiaqgaldaaiaytkerkqfgrpvsdnqgvqfmladma mkieaarlmvysaaaraergegdlgfisaaskcfasdvamevttdavqlfggygytqdfp vermmrdakitqiyegtnqiqrvvmsrallr
>d3pfdd2 a.29.3.0 (D:239-389) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]} tgfktalatldhtrptigaqavgiaqgaldaaiaytkerkqfgrpvsdnqgvqfmladma mkieaarlmvysaaaraerglgfisaaskcfasdvamevttdavqlfggygytqdfpver mmrdakitqiyegtnqiqrvvmsrallr
Timeline for d3pfdd2: