Lineage for d3pfdd1 (3pfd D:18-238)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451317Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1451318Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1451455Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 1451456Protein automated matches [226934] (14 species)
    not a true protein
  7. 1451533Species Mycobacterium thermoresistibile [TaxId:1797] [225912] (2 PDB entries)
  8. 1451537Domain d3pfdd1: 3pfd D:18-238 [214762]
    Other proteins in same PDB: d3pfda2, d3pfdb2, d3pfdc2, d3pfdd2
    automated match to d1jqia2
    complexed with fda, iod

Details for d3pfdd1

PDB Entry: 3pfd (more details), 2.1 Å

PDB Description: crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr
PDB Compounds: (D:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d3pfdd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pfdd1 e.6.1.0 (D:18-238) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
ehialreairalaekeiapyaaevdekarfpeealaalnssgfsaihvpeeyggqgadsv
atcivieevarvdcsaslipavnklgtmglilrgseelkkqvlpavasgeamasyalser
eagsdaasmrtravadgddwilngskcwitnggkstwytvmavtdpdkgangisafmvhk
ddegftvgpkerklgikgspttelyfencripgdriigepg

SCOPe Domain Coordinates for d3pfdd1:

Click to download the PDB-style file with coordinates for d3pfdd1.
(The format of our PDB-style files is described here.)

Timeline for d3pfdd1: