SCOPe 2.03: Domain d3pfdd1: 3pfd D:18-238

Lineage for d3pfdd1 (3pfd D:18-238)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (14 species)
   not a true protein

7. Species Mycobacterium thermoresistibile [TaxId:1797] [225912] (2 PDB entries)

8. Domain d3pfdd1: 3pfd D:18-238 [214762]
   Other proteins in same PDB: d3pfda2, d3pfdb2, d3pfdc2, d3pfdd2
   automated match to d1jqia2
   complexed with fda, iod

Details for d3pfdd1

PDB Entry: 3pfd, 2.1 Å

PDB Description: crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr

PDB Compounds: (D:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d3pfdd1:

Sequence; same for both SEQRES and ATOM records:

>d3pfdd1 e.6.1.0 (D:18-238) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
ehialreairalaekeiapyaaevdekarfpeealaalnssgfsaihvpeeyggqgadsv
atcivieevarvdcsaslipavnklgtmglilrgseelkkqvlpavasgeamasyalser
eagsdaasmrtravadgddwilngskcwitnggkstwytvmavtdpdkgangisafmvhk
ddegftvgpkerklgikgspttelyfencripgdriigepg

Timeline for d3pfdd1:

• d3pfdd1 is new in SCOPe 2.03-stable
  
• d3pfdd1 appears in SCOPe 2.04
  
• d3pfdd1 appears in the current release, SCOPe 2.08