SCOPe 2.08: Domain d3pfdb2: 3pfd B:239-389

Lineage for d3pfdb2 (3pfd B:239-389)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (30 species)
   not a true protein

7. Species Mycobacterium thermoresistibile [TaxId:1797] [225913] (2 PDB entries)

8. Domain d3pfdb2: 3pfd B:239-389 [214759]
   Other proteins in same PDB: d3pfda1, d3pfdb1, d3pfdc1, d3pfdd1
   automated match to d1jqia1
   complexed with fda, iod

Details for d3pfdb2

PDB Entry: 3pfd, 2.1 Å

PDB Description: crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr

PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d3pfdb2:

Sequence, based on SEQRES records:

>d3pfdb2 a.29.3.0 (B:239-389) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
tgfktalatldhtrptigaqavgiaqgaldaaiaytkerkqfgrpvsdnqgvqfmladma
mkieaarlmvysaaaraergegdlgfisaaskcfasdvamevttdavqlfggygytqdfp
vermmrdakitqiyegtnqiqrvvmsrallr

Sequence, based on observed residues (ATOM records):

>d3pfdb2 a.29.3.0 (B:239-389) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
tgfktalatldhtrptigaqavgiaqgaldaaiaytkerkqfgrpvsdnqgvqfmladma
mkieaarlmvysaaaraerggfisaaskcfasdvamevttdavqlfggygytqdfpverm
mrdakitqiyegtnqiqrvvmsrallr

Timeline for d3pfdb2:

• d3pfdb2 first appeared in SCOPe 2.03
  
• d3pfdb2 appears in SCOPe 2.07