Lineage for d3pfda1 (3pfd A:18-238)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246106Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2246107Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2246252Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2246253Protein automated matches [226934] (25 species)
    not a true protein
  7. 2246379Species Mycobacterium thermoresistibile [TaxId:1797] [225912] (2 PDB entries)
  8. 2246380Domain d3pfda1: 3pfd A:18-238 [214756]
    Other proteins in same PDB: d3pfda2, d3pfdb2, d3pfdc2, d3pfdd2
    automated match to d1jqia2
    complexed with fda, iod

Details for d3pfda1

PDB Entry: 3pfd (more details), 2.1 Å

PDB Description: crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr
PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d3pfda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pfda1 e.6.1.0 (A:18-238) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
ehialreairalaekeiapyaaevdekarfpeealaalnssgfsaihvpeeyggqgadsv
atcivieevarvdcsaslipavnklgtmglilrgseelkkqvlpavasgeamasyalser
eagsdaasmrtravadgddwilngskcwitnggkstwytvmavtdpdkgangisafmvhk
ddegftvgpkerklgikgspttelyfencripgdriigepg

SCOPe Domain Coordinates for d3pfda1:

Click to download the PDB-style file with coordinates for d3pfda1.
(The format of our PDB-style files is described here.)

Timeline for d3pfda1: