Lineage for d3pbfa2 (3pbf A:110-228)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2234639Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2235028Protein Surfactant protein, lectin domain [56461] (3 species)
  7. 2235057Species Norway rat (Rattus norvegicus), SP-A [TaxId:10116] [103352] (15 PDB entries)
  8. 2235058Domain d3pbfa2: 3pbf A:110-228 [214753]
    Other proteins in same PDB: d3pbfa1
    automated match to d1r13a1
    complexed with ca, gol

Details for d3pbfa2

PDB Entry: 3pbf (more details), 1.8 Å

PDB Description: Surfactant Protein-A neck and carbohydrate recognition domain (NCRD) complexed with glycerol
PDB Compounds: (A:) Pulmonary surfactant-associated protein A

SCOPe Domain Sequences for d3pbfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pbfa2 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Norway rat (Rattus norvegicus), SP-A [TaxId: 10116]}
smlsvgdkvfstngqsvnfdtikemctraggniavprtpeeneaiasiakkynnyvylgm
iedqtpgdfhyldgasvsytnwypgeprgqgkekcvemytdgtwndrgclqyrlavcef

SCOPe Domain Coordinates for d3pbfa2:

Click to download the PDB-style file with coordinates for d3pbfa2.
(The format of our PDB-style files is described here.)

Timeline for d3pbfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pbfa1