SCOPe 2.08: Domain d3pbfa2: 3pbf A:110-228

Lineage for d3pbfa2 (3pbf A:110-228)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Surfactant protein, lectin domain [56461] (3 species)

7. Species Norway rat (Rattus norvegicus), SP-A [TaxId:10116] [103352] (15 PDB entries)

8. Domain d3pbfa2: 3pbf A:110-228 [214753]
   Other proteins in same PDB: d3pbfa1
   automated match to d1r13a1
   complexed with ca, gol

Details for d3pbfa2

PDB Entry: 3pbf, 1.8 Å

PDB Description: Surfactant Protein-A neck and carbohydrate recognition domain (NCRD) complexed with glycerol

PDB Compounds: (A:) Pulmonary surfactant-associated protein A

SCOPe Domain Sequences for d3pbfa2:

Sequence; same for both SEQRES and ATOM records:

>d3pbfa2 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Norway rat (Rattus norvegicus), SP-A [TaxId: 10116]}
smlsvgdkvfstngqsvnfdtikemctraggniavprtpeeneaiasiakkynnyvylgm
iedqtpgdfhyldgasvsytnwypgeprgqgkekcvemytdgtwndrgclqyrlavcef

Timeline for d3pbfa2:

• d3pbfa2 first appeared in SCOPe 2.03
  
• d3pbfa2 appears in SCOPe 2.07