Lineage for d3paua3 (3pau A:336-516)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1302646Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1302647Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1303271Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1303395Protein multi-copper oxidase CueO [69194] (1 species)
  7. 1303396Species Escherichia coli [TaxId:562] [69195] (11 PDB entries)
  8. 1303423Domain d3paua3: 3pau A:336-516 [214748]
    automated match to d1n68a3
    complexed with c2o, cu

Details for d3paua3

PDB Entry: 3pau (more details), 2 Å

PDB Description: CueO in the resting oxidized state
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d3paua3:

Sequence, based on SEQRES records: (download)

>d3paua3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh
mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril
sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgft
v

Sequence, based on observed residues (ATOM records): (download)

>d3paua3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagfdfhhankingqafdmn
kpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahragwkdtvkvegn
vsevlvkfnhdapkehaymahchllehedtgmmlgftv

SCOPe Domain Coordinates for d3paua3:

Click to download the PDB-style file with coordinates for d3paua3.
(The format of our PDB-style files is described here.)

Timeline for d3paua3: