Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Surfactant protein, lectin domain [56461] (3 species) |
Species Norway rat (Rattus norvegicus), SP-A [TaxId:10116] [103352] (15 PDB entries) |
Domain d3para2: 3par A:110-228 [214745] Other proteins in same PDB: d3para1 automated match to d1r13a1 complexed with ca, so4 |
PDB Entry: 3par (more details), 2.3 Å
SCOPe Domain Sequences for d3para2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3para2 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Norway rat (Rattus norvegicus), SP-A [TaxId: 10116]} smlsvgdkvfstngqsvnfdtikemctraggniavprtpeeneaiasiakkynnyvylgm iedqtpgdfhyldgasvsytnwypgeprgqgkekcvemytdgtwndrgclqyrlavcef
Timeline for d3para2: