Lineage for d3para2 (3par A:110-228)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607677Protein Surfactant protein, lectin domain [56461] (3 species)
  7. 2607712Species Norway rat (Rattus norvegicus), SP-A [TaxId:10116] [103352] (15 PDB entries)
  8. 2607722Domain d3para2: 3par A:110-228 [214745]
    Other proteins in same PDB: d3para1
    automated match to d1r13a1
    complexed with ca, so4

Details for d3para2

PDB Entry: 3par (more details), 2.3 Å

PDB Description: Surfactant Protein-A neck and carbohydrate recognition domain (NCRD) in the absence of ligand
PDB Compounds: (A:) Pulmonary surfactant-associated protein A

SCOPe Domain Sequences for d3para2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3para2 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Norway rat (Rattus norvegicus), SP-A [TaxId: 10116]}
smlsvgdkvfstngqsvnfdtikemctraggniavprtpeeneaiasiakkynnyvylgm
iedqtpgdfhyldgasvsytnwypgeprgqgkekcvemytdgtwndrgclqyrlavcef

SCOPe Domain Coordinates for d3para2:

Click to download the PDB-style file with coordinates for d3para2.
(The format of our PDB-style files is described here.)

Timeline for d3para2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3para1