Lineage for d3pajb2 (3paj B:129-294)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1345499Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 1345571Family c.1.17.0: automated matches [227169] (1 protein)
    not a true family
  6. 1345572Protein automated matches [226879] (6 species)
    not a true protein
  7. 1345592Species Vibrio cholerae [TaxId:243277] [226021] (1 PDB entry)
  8. 1345594Domain d3pajb2: 3paj B:129-294 [214739]
    Other proteins in same PDB: d3paja1, d3pajb1
    automated match to d1qapa1
    complexed with mg

Details for d3pajb2

PDB Entry: 3paj (more details), 2 Å

PDB Description: 2.00 angstrom resolution crystal structure of a quinolinate phosphoribosyltransferase from vibrio cholerae o1 biovar eltor str. n16961
PDB Compounds: (B:) Nicotinate-nucleotide pyrophosphorylase, carboxylating

SCOPe Domain Sequences for d3pajb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pajb2 c.1.17.0 (B:129-294) automated matches {Vibrio cholerae [TaxId: 243277]}
catataryvqelkgtqcrlldtrktipglrsalkyavacgggynhrigvfdaylikenhi
iacggirqaistakqlnpgkpvevetetlaeleeaisagadiimldnfslemmreavkin
agraalensgnitldnlkecaetgvdyisvgaltkhlkaldlsmrf

SCOPe Domain Coordinates for d3pajb2:

Click to download the PDB-style file with coordinates for d3pajb2.
(The format of our PDB-style files is described here.)

Timeline for d3pajb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pajb1