![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) ![]() incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
![]() | Family c.1.17.0: automated matches [227169] (1 protein) not a true family |
![]() | Protein automated matches [226879] (6 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:243277] [226021] (1 PDB entry) |
![]() | Domain d3paja2: 3paj A:129-296 [214737] Other proteins in same PDB: d3paja1, d3pajb1 automated match to d1qapa1 complexed with mg |
PDB Entry: 3paj (more details), 2 Å
SCOPe Domain Sequences for d3paja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3paja2 c.1.17.0 (A:129-296) automated matches {Vibrio cholerae [TaxId: 243277]} catataryvqelkgtqcrlldtrktipglrsalkyavacgggynhrigvfdaylikenhi iacggirqaistakqlnpgkpvevetetlaeleeaisagadiimldnfslemmreavkin agraalensgnitldnlkecaetgvdyisvgaltkhlkaldlsmrfks
Timeline for d3paja2: