SCOPe 2.03: Domain d3paja1: 3paj A:-5-128

Lineage for d3paja1 (3paj A:-5-128)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (3 families)

5. Family d.41.2.0: automated matches [227168] (1 protein)
   not a true family

6. Protein automated matches [226878] (6 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [226020] (1 PDB entry)

8. Domain d3paja1: 3paj A:-5-128 [214736]
   Other proteins in same PDB: d3paja2, d3pajb2
   automated match to d1qapa2
   complexed with mg

Details for d3paja1

PDB Entry: 3paj, 2 Å

PDB Description: 2.00 angstrom resolution crystal structure of a quinolinate phosphoribosyltransferase from vibrio cholerae o1 biovar eltor str. n16961

PDB Compounds: (A:) Nicotinate-nucleotide pyrophosphorylase, carboxylating

SCOPe Domain Sequences for d3paja1:

Sequence; same for both SEQRES and ATOM records:

>d3paja1 d.41.2.0 (A:-5-128) automated matches {Vibrio cholerae [TaxId: 243277]}
yfqsnamkethnsqdrlaylkqqlpaditrsvidtlkedlggtldpaaditaslipadri
statiitreagvfcgqlwadevfkqlggqvsiewhvqdgdtltpnqtlctltgparillt
gernamnfiqtlsg

Timeline for d3paja1:

• d3paja1 is new in SCOPe 2.03-stable
  
• d3paja1 appears in SCOPe 2.04
  
• d3paja1 appears in the current release, SCOPe 2.08