SCOPe 2.08: Domain d3paeb_: 3pae B:

Lineage for d3paeb_ (3pae B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [194613] (64 PDB entries)

8. Domain d3paeb_: 3pae B: [214733]
   automated match to d1k38a_
   complexed with 4j6, so4; mutant

Details for d3paeb_

PDB Entry: 3pae, 2.1 Å

PDB Description: crystal structure of the k84d mutant of oxa-24/40 in complex with doripenem

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d3paeb_:

Sequence; same for both SEQRES and ATOM records:

>d3paeb_ e.3.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
hissqqhekaiksyfdeaqtqgviiikegknlstygnalarankeyvpastfdmlnalig
lenhkattneifkwdgkkrtypmwekdmtlgeamalsavpvyqelarrtglelmqkevkr
vnfgntnigtqvdnfwlvgplkitpvqevnfaddlahnrlpfkletqeevkkmllikevn
gskiyaksgwgmgvtpqvgwltgwveqangkkipfslnlemkegmsgsirneitykslen
lgii

Timeline for d3paeb_:

• d3paeb_ first appeared in SCOPe 2.03
  
• d3paeb_ appears in SCOPe 2.07