SCOP 1.75: Domain d1dclb2: 1dcl B:112-216

Lineage for d1dclb2 (1dcl B:112-216)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)

8. Domain d1dclb2: 1dcl B:112-216 [21473]
   Other proteins in same PDB: d1dcla1, d1dclb1
   part of the antibody MCG light chain dimer

Details for d1dclb2

PDB Entry: 1dcl, 2.3 Å

PDB Description: mcg, a lambda v type light-chain dimer (bence-jones protein), crystallized from ammonium sulfate

PDB Compounds: (B:) mcg

SCOP Domain Sequences for d1dclb2:

Sequence; same for both SEQRES and ATOM records:

>d1dclb2 b.1.1.2 (B:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

Timeline for d1dclb2:

• d1dclb2 first appeared (with stable ids) in SCOP 1.55
  
• d1dclb2 appears in SCOP 1.73
  
• d1dclb2 appears in SCOPe 2.01
  
• d1dclb2 appears in the current release, SCOPe 2.08