| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
| Species Lambda L chain dimer MCG (human) [49117] (18 PDB entries) |
| Domain d1dclb2: 1dcl B:112-216 [21473] Other proteins in same PDB: d1dcla1, d1dclb1 |
PDB Entry: 1dcl (more details), 2.3 Å
SCOP Domain Sequences for d1dclb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dclb2 b.1.1.2 (B:112-216) Immunoglobulin (constant domains of L and H chains) {Lambda L chain dimer MCG (human)}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
Timeline for d1dclb2: