Lineage for d3p9kb1 (3p9k B:5-116)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1260111Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1260112Protein automated matches [190154] (41 species)
    not a true protein
  7. 1260230Species Lolium perenne [TaxId:4522] [226053] (3 PDB entries)
  8. 1260237Domain d3p9kb1: 3p9k B:5-116 [214724]
    Other proteins in same PDB: d3p9ka2, d3p9kb2, d3p9kc2, d3p9kd2
    automated match to d1kyze1
    complexed with ciy, sah

Details for d3p9kb1

PDB Entry: 3p9k (more details), 2.25 Å

PDB Description: Crystal structure of perennial ryegrass LpOMT1 complexed with S-adenosyl-L-homocysteine and coniferaldehyde
PDB Compounds: (B:) Caffeic acid O-methyltransferase

SCOPe Domain Sequences for d3p9kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p9kb1 a.4.5.0 (B:5-116) automated matches {Lolium perenne [TaxId: 4522]}
aadmaasadedacmfalqlasssvlpmtlknaielglleilvaaggksltptevaaklps
aanpeapdmvdrilrllasynvvtclveegkdgrlsrsygaapvckfltpne

SCOPe Domain Coordinates for d3p9kb1:

Click to download the PDB-style file with coordinates for d3p9kb1.
(The format of our PDB-style files is described here.)

Timeline for d3p9kb1: