SCOPe 2.08: Domain d3p9ka1: 3p9k A:4-116

Lineage for d3p9ka1 (3p9k A:4-116)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Lolium perenne [TaxId:4522] [226053] (3 PDB entries)

8. Domain d3p9ka1: 3p9k A:4-116 [214722]
   Other proteins in same PDB: d3p9ka2, d3p9kb2, d3p9kc2, d3p9kd2
   automated match to d1kyze1
   complexed with ciy, sah

Details for d3p9ka1

PDB Entry: 3p9k, 2.25 Å

PDB Description: Crystal structure of perennial ryegrass LpOMT1 complexed with S-adenosyl-L-homocysteine and coniferaldehyde

PDB Compounds: (A:) Caffeic acid O-methyltransferase

SCOPe Domain Sequences for d3p9ka1:

Sequence; same for both SEQRES and ATOM records:

>d3p9ka1 a.4.5.0 (A:4-116) automated matches {Lolium perenne [TaxId: 4522]}
taadmaasadedacmfalqlasssvlpmtlknaielglleilvaaggksltptevaaklp
saanpeapdmvdrilrllasynvvtclveegkdgrlsrsygaapvckfltpne

Timeline for d3p9ka1:

• d3p9ka1 first appeared in SCOPe 2.03
  
• d3p9ka1 appears in SCOPe 2.07