SCOPe 2.05: Domain d3p9id2: 3p9i D:117-360

Lineage for d3p9id2 (3p9i D:117-360)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (49 species)
   not a true protein

7. Species Lolium perenne [TaxId:4522] [226054] (3 PDB entries)

8. Domain d3p9id2: 3p9i D:117-360 [214721]
   Other proteins in same PDB: d3p9ia1, d3p9ib1, d3p9ic1, d3p9id1
   automated match to d1kyzc2
   complexed with bme, sah, sny

Details for d3p9id2

PDB Entry: 3p9i, 1.85 Å

PDB Description: crystal structure of perennial ryegrass lpomt1 complexed with s- adenosyl-l-homocysteine and sinapaldehyde

PDB Compounds: (D:) Caffeic acid O-methyltransferase

SCOPe Domain Sequences for d3p9id2:

Sequence; same for both SEQRES and ATOM records:

>d3p9id2 c.66.1.0 (D:117-360) automated matches {Lolium perenne [TaxId: 4522]}
dgvsmaalalmnqdkvlmeswyylkdavldggipfnkaygmsafeyhgtdprfnrvfneg
mknhsiiitkkllelyhgfeglgtlvdvgggvgatvaaiaahyptikgvnfdlphvisea
pqfpgvthvggdmfkevpsgdtilmkwilhdwsdqhcatllkncydalpahgkvvlvqci
lpvnpeanpssqgvfhvdmimlahnpggreryerefqalargagftgvkstyiyanawai
eftk

Timeline for d3p9id2:

• d3p9id2 first appeared in SCOPe 2.03
  
• d3p9id2 appears in SCOPe 2.04
  
• d3p9id2 appears in SCOPe 2.06
  
• d3p9id2 appears in the current release, SCOPe 2.08