| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Lolium perenne [TaxId:4522] [226053] (3 PDB entries) |
| Domain d3p9ic1: 3p9i C:4-116 [214718] Other proteins in same PDB: d3p9ia2, d3p9ib2, d3p9ic2, d3p9id2 automated match to d1kyze1 complexed with bme, sah, sny |
PDB Entry: 3p9i (more details), 1.85 Å
SCOPe Domain Sequences for d3p9ic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p9ic1 a.4.5.0 (C:4-116) automated matches {Lolium perenne [TaxId: 4522]}
taadmaasadedacmfalqlasssvlpmtlknaielglleilvaaggksltptevaaklp
saanpeapdmvdrilrllasynvvtclveegkdgrlsrsygaapvckfltpne
Timeline for d3p9ic1: