| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
| Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
| Protein automated matches [190689] (87 species) not a true protein |
| Species Lolium perenne [TaxId:4522] [226054] (3 PDB entries) |
| Domain d3p9ia2: 3p9i A:117-360 [214715] Other proteins in same PDB: d3p9ia1, d3p9ib1, d3p9ic1, d3p9id1 automated match to d1kyzc2 complexed with bme, sah, sny |
PDB Entry: 3p9i (more details), 1.85 Å
SCOPe Domain Sequences for d3p9ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p9ia2 c.66.1.0 (A:117-360) automated matches {Lolium perenne [TaxId: 4522]}
dgvsmaalalmnqdkvlmeswyylkdavldggipfnkaygmsafeyhgtdprfnrvfneg
mknhsiiitkkllelyhgfeglgtlvdvgggvgatvaaiaahyptikgvnfdlphvisea
pqfpgvthvggdmfkevpsgdtilmkwilhdwsdqhcatllkncydalpahgkvvlvqci
lpvnpeanpssqgvfhvdmimlahnpggreryerefqalargagftgvkstyiyanawai
eftk
Timeline for d3p9ia2: