Lineage for d3p9ia1 (3p9i A:4-116)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (73 species)
    not a true protein
  7. 2307396Species Lolium perenne [TaxId:4522] [226053] (3 PDB entries)
  8. 2307398Domain d3p9ia1: 3p9i A:4-116 [214714]
    Other proteins in same PDB: d3p9ia2, d3p9ib2, d3p9ic2, d3p9id2
    automated match to d1kyze1
    complexed with bme, sah, sny

Details for d3p9ia1

PDB Entry: 3p9i (more details), 1.85 Å

PDB Description: Crystal structure of perennial ryegrass LpOMT1 complexed with S-adenosyl-L-homocysteine and sinapaldehyde
PDB Compounds: (A:) Caffeic acid O-methyltransferase

SCOPe Domain Sequences for d3p9ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p9ia1 a.4.5.0 (A:4-116) automated matches {Lolium perenne [TaxId: 4522]}
taadmaasadedacmfalqlasssvlpmtlknaielglleilvaaggksltptevaaklp
saanpeapdmvdrilrllasynvvtclveegkdgrlsrsygaapvckfltpne

SCOPe Domain Coordinates for d3p9ia1:

Click to download the PDB-style file with coordinates for d3p9ia1.
(The format of our PDB-style files is described here.)

Timeline for d3p9ia1: