Lineage for d3p9ca2 (3p9c A:117-360)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502480Species Lolium perenne [TaxId:4522] [226054] (3 PDB entries)
  8. 2502481Domain d3p9ca2: 3p9c A:117-360 [214711]
    Other proteins in same PDB: d3p9ca1
    automated match to d1kyzc2
    complexed with act, dtv, edo, sah

Details for d3p9ca2

PDB Entry: 3p9c (more details), 1.8 Å

PDB Description: Crystal structure of perennial ryegrass LpOMT1 bound to SAH
PDB Compounds: (A:) Caffeic acid O-methyltransferase

SCOPe Domain Sequences for d3p9ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p9ca2 c.66.1.0 (A:117-360) automated matches {Lolium perenne [TaxId: 4522]}
dgvsmaalalmnqdkvlmeswyylkdavldggipfnkaygmsafeyhgtdprfnrvfneg
mknhsiiitkkllelyhgfeglgtlvdvgggvgatvaaiaahyptikgvnfdlphvisea
pqfpgvthvggdmfkevpsgdtilmkwilhdwsdqhcatllkncydalpahgkvvlvqci
lpvnpeanpssqgvfhvdmimlahnpggreryerefqalargagftgvkstyiyanawai
eftk

SCOPe Domain Coordinates for d3p9ca2:

Click to download the PDB-style file with coordinates for d3p9ca2.
(The format of our PDB-style files is described here.)

Timeline for d3p9ca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3p9ca1