Lineage for d3p9ca2 (3p9c A:117-360)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) 
Family c.66.1.0: automated matches [191451] (1 protein)
not a true familyProtein automated matches [190689] (87 species)
not a true protein
Species Lolium perenne [TaxId:4522] [226054] (3 PDB entries) 
Domain d3p9ca2: 3p9c A:117-360 [214711]
Other proteins in same PDB: d3p9ca1
automated match to d1kyzc2
complexed with act, dtv, edo, sah
Details for d3p9ca2
PDB Entry: 3p9c (more details), 1.8 Å
PDB Description: Crystal structure of perennial ryegrass LpOMT1 bound to SAH
PDB Compounds: (A:) Caffeic acid O-methyltransferaseSCOPe Domain Sequences for d3p9ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p9ca2 c.66.1.0 (A:117-360) automated matches {Lolium perenne [TaxId: 4522]}
dgvsmaalalmnqdkvlmeswyylkdavldggipfnkaygmsafeyhgtdprfnrvfneg
mknhsiiitkkllelyhgfeglgtlvdvgggvgatvaaiaahyptikgvnfdlphvisea
pqfpgvthvggdmfkevpsgdtilmkwilhdwsdqhcatllkncydalpahgkvvlvqci
lpvnpeanpssqgvfhvdmimlahnpggreryerefqalargagftgvkstyiyanawai
eftk
SCOPe Domain Coordinates for d3p9ca2:
Click to download the PDB-style file with coordinates for d3p9ca2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3p9ca2:
- d3p9ca2 first appeared in SCOPe 2.03
- d3p9ca2 appears in SCOPe 2.07
View in 3D
